PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019274
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 496aa    MW: 54270.4 Da    PI: 8.9744
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019274genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.33.2e-24169213145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++ +++k+CErH+++gr+rsrk++e 
  Lus10019274 169 DPEPGRCRRTDGKKWRCSRDAFADQKYCERHISKGRHRSRKPVEG 213
                  79****************************************985 PP

2QLQ54.34e-1994130137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+ +L++Q+l+yKy+ an+ vP++Ll +i+k
  Lus10019274  94 GPFTPSQWIELEHQALIYKYITANVAVPSNLLNPIKK 130
                  59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.8E-1094130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.00595130IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-1395128IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072169213IPR014977WRC domain
PfamPF088791.9E-20170212IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MDFGVLGLDV GHPPLHPPQL EIASSASAQD VVWMKPSKIQ RTSEDEQQQQ QQQQNVDFSP  60
PNRTILRSNS TSYYPPPAPP PGSSLNVTMH GVRGPFTPSQ WIELEHQALI YKYITANVAV  120
PSNLLNPIKK SLYPFALCSN NTISSAASFI PSHLGWGAFH LGYPGSANDP EPGRCRRTDG  180
KKWRCSRDAF ADQKYCERHI SKGRHRSRKP VEGTKVVSTN SNSNAAAAAG ANVRAASNCI  240
SITQQQLKYM QQLTAHRNSS PDAFPNRFTL TDVNANTNGR FQVPQAPKKN FAIKESPYSE  300
FGHVSFDSSL NPSQHKNTSG GCSYNSFLNF NGQDHTQDQH SLHQFMDNDW PKDHQSSRNV  360
ITWPEDQLKS DWTQLSMSIP MTSSPPHEKL ALSPLRLSRE LDTKQTASWM RIPWGGASMG  420
GGPLGEALSG NVKSTVTEEL GFSPTGVLQK ATFGSLSNNS SSGSSPRGGD ESKRNHLCED  480
LIGSRIASSI AVPYL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818757e-39LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132627e-39LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466427.11e-118PREDICTED: growth-regulating factor 1
TrEMBLA0A067GGN01e-118A0A067GGN0_CITSI; Uncharacterized protein
STRINGPOPTR_0014s00780.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.15e-79growth-regulating factor 1